PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07490
Common NameKK1_007695
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CPP
Protein Properties Length: 725aa    MW: 79159.6 Da    PI: 6.5389
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07490genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25.3e-16439477240
            TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    ++k+CnCkkskClk+YCeCfaag++C e C C dC+Nk 
  C.cajan_07490 439 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCACRDCFNKP 477
                    689**********************************96 PP

2TCR512.9e-16524563140
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN+ 
  C.cajan_07490 524 RHKRGCNCKKSSCLKKYCECYQGGVGCSISCRCEGCKNTF 563
                    589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.3E-18438479IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.676439564IPR005172CRC domain
PfamPF036381.6E-11441476IPR005172CRC domain
SMARTSM011141.3E-17524565IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.8E-12526562IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MDTPDRSKIN TPLSQFEDSP VFNYISNLSP IEPVKSVHIT QTFNSLSFSS PPSVFTSPHV  60
NCHKESRFFR RHNLLDTSKP KVPSEDANNV YSCEETPADS IHDACRESRE LQENTDKRVS  120
TGDASIEQYV AYVPEGSEKG SIEGEMHLPE LCQIEEKLEG QDCGVDGLIT EASDLLKFSS  180
QNVTEAFKGL NKQLNPSIQL SNSMTTLPQS AINDGHKMHI VNAVASGSEH EIEDRPSEAA  240
AATDTSQRQD NLANVALMAS NPSEKMDDKL VYVTHRGIRR RCLDFEMASV QRKNSDDNSN  300
TNSSTVKSDV RNVGNEKQLL PTKHSGDSRR CVLPGIGLHL NALATFNDCK NIKIENLSSG  360
RQPNLSSSSS LQLSASQEHQ LSLVAMSVEG DLEPSENEVQ PGEDCAQSLV HVEGEDIQQN  420
SPKKKRLVQL LIISGEGESC KRCNCKKSKC LKLYCECFAA GVYCIEPCAC RDCFNKPIHV  480
DTVLQTRQQI ESRNPLAFAP KVIRSSDSVP EIGDDPNKTP ASARHKRGCN CKKSSCLKKY  540
CECYQGGVGC SISCRCEGCK NTFGRKDGSV PSGIGAEPEE ETEACEKGVV ENATQKYEIQ  600
NTEDHPDCAL AATPLQLSRP LLPLPFSSKG KPPRSFVTTI SSSGLFVSQK LGKSNASRSQ  660
PKIEKPLQTV PDDDSPATCI KTSSPNGKRI SSPNCDVGSS SPTRRGGRKL ILQSIPSFPS  720
LTPHH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143298.10.0hypothetical protein PHAVU_007G060500g
TrEMBLA0A151U6S70.0A0A151U6S7_CAJCA; Protein lin-54 isogeny
STRINGGLYMA20G28740.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-123TESMIN/TSO1-like CXC 2